Recombinant Human IMP4 Protein

Recombinant Human IMP4 Protein
SKU
ASBPP-3100-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q96G21

Gene Name: IMP4

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu11

End Site: Val80

Coverage: 0.27

Isoelectric Point: 7

Core Sequence: EYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEYRWAGV

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 92%, Cynomolgus monkey - 99%

Alternative gene names: BXDC4

Alternative protein names: U3 small nucleolar ribonucleoprotein protein IMP4; U3 snoRNP protein IMP4; Brix domain-containing protein 4

Protein name: IMP U3 small nucleolar ribonucleoprotein 4

Full length: 291 amino acids

Entry name: IMP4_HUMAN
More Information
SKU ASBPP-3100-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3100-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 92856
Product information (PDF)
×
MSDS (PDF)
×