Recombinant Human INCENP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NQS7

Gene Name: INCENP

Expression System: Escherichia coli

Molecular Weight: 21.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 81%

Start Site: Glu741

End Site: Ser910

Coverage: 0.19

Isoelectric Point: 8

Core Sequence: EKALRLQKEQLQRELEEKKKKEEQQRLAERQLQEEQEKKAKEAAGASKALNVTVDVQSPACTSYQMTPQGHRAPPKINPDNYGMDLNSDDSTDDEAHPRKPIPTWARGTPLSQAIIHQYYHPPNLLELFGTILPLDLEDIFKKSKPRYHKRTSSAVWNSPPLQGARVPSS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 81%, Pig - 92%, Cynomolgus monkey - 97%

Alternative gene names: /

Alternative protein names: Inner centromere protein

Protein name: inner centromere protein

Full length: 918 amino acids

Entry name: INCE_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-399-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-399-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3619