Recombinant Human INO80B Protein

Recombinant Human INO80B Protein
SKU
ASBPP-10455-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9C086

Gene Name: INO80B

Expression System: Escherichia coli

Molecular Weight: 24.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Ser11

End Site: Glu210

Coverage: 0.59

Isoelectric Point: 7

Core Sequence: SGAMEAPEPGEALELSLAGAHGHGVHKKKHKKHKKKHKKKHHQEEDAGPTQPSPAKPQLKLKIKLGGQVLGTKSVPTFTVIPEGPRSPSPLMVVDNEEEPMEGVPLEQYRAWLDEDSNLSPSPLRDLSGGLGGQEEEEEQRWLDALEKGELDDNGDLKKEINERLLTARQRALLQKARSQPSPMLPLPVAEGCPPPALTE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: HMGA1L4; PAPA1; ZNHIT4

Alternative protein names: INO80 complex subunit B; High mobility group AT-hook 1-like 4; IES2 homolog; hIes2; PAP-1-associated protein 1; PAPA-1; Zinc finger HIT domain-containing protein 4

Protein name: INO80 complex subunit B

Full length: 356 amino acids

Entry name: IN80B_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10455-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10455-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 83444
Product information (PDF)
×
MSDS (PDF)
×