Recombinant Human INPP5J Protein

Recombinant Human INPP5J Protein
SKU
ASBPP-4285-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q15735

Gene Name: INPP5J

Expression System: Escherichia coli

Molecular Weight: 36.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Arg11

End Site: Arg350

Coverage: 0.35

Isoelectric Point: 11

Core Sequence: RPGTRAGLGSLPMPQGVAQTGAPSKVDSSFQLPAKKNAALGPSEPRLALAPVGPRAAMSASSEGPRLALASPRPILAPLCTPEGQKTATAHRSSSLAPTSVGQLVMSASAGPKPPPATTGSVLAPTSLGLVMPASAGPRSPPVTLGPNLAPTSRDQKQEPPASVGPKPTLAASGLSLALASEEQPPELPSTPSPVPSPVLSPTQEQALAPASTASGAASVGQTSARKRDAPAPRPLPASEGHLQPPAQTSGPTGSPPCIQTSPDPRLSPSFRARPEALHSSPEDPVLPRPPQTLPLDVGQGPSEPGTHSPGLLSPTFRPGAPSGQTVPPPLPKPPRSPSR

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 69%, Pig - 76%, Cynomolgus monkey - 91%

Alternative gene names: PIB5PA; PIPP

Alternative protein names: Phosphatidylinositol 4; 5-bisphosphate 5-phosphatase A; Inositol polyphosphate 5-phosphatase J; Phosphatidylinositol 1; 3; 4; 5-tetrakisphosphate 5-phosphatase; Phosphatidylinositol 1; 4; 5-trisphosphate 5-phosphatase

Protein name: inositol polyphosphate-5-phosphatase J

Full length: 1006 amino acids

Entry name: PI5PA_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4285-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4285-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 27124
Product information (PDF)
×
MSDS (PDF)
×