Recombinant Human INTS9 Protein

Recombinant Human INTS9 Protein
SKU
ASBPP-3126-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9NV88

Gene Name: INTS9

Expression System: Escherichia coli

Molecular Weight: 10 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Val571

End Site: Asp640

Coverage: 0.12

Isoelectric Point: 6

Core Sequence: VSDDVPDCKVLKPLLSGSIPVEQFVQTLEKHGFSDIKVEDTAKGHIVLLQEAETLIQIEEDSTHIICDND

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 93%, Cynomolgus monkey - 100%

Alternative gene names: RC74

Alternative protein names: Integrator complex subunit 9; Int9; Protein related to CPSF subunits of 74 kDa; RC-74

Protein name: integrator complex subunit 9

Full length: 658 amino acids

Entry name: INT9_HUMAN
More Information
SKU ASBPP-3126-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3126-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 55756
Product information (PDF)
×
MSDS (PDF)
×