Recombinant Human ISG20L2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H9L3

Gene Name: ISG20L2

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 57%

Start Site: Gly11

End Site: Gly170

Coverage: 0.50

Isoelectric Point: 11

Core Sequence: GEPPPKKALEGNAKHRNFVKKRRLLERRGFLSKKNQPPSKAPKLHSEPSKKGETPTVDGTWKTPSFPKKKTAASSNGSGQPLDKKAAVSWLTPAPSKKADSVAAKVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHSENKCSG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 57%, Rat - 59%, Pig - 77%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Interferon-stimulated 20 kDa exonuclease-like 2

Protein name: interferon stimulated exonuclease gene 20 like 2

Full length: 353 amino acids

Entry name: I20L2_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3094-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3094-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 81875