Recombinant Human KCNG1 Protein

Recombinant Human KCNG1 Protein
SKU
ASBPP-3201-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UIX4

Gene Name: KCNG1

Expression System: Escherichia coli

Molecular Weight: 26.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 89%

Start Site: Tyr11

End Site: Pro220

Coverage: 0.42

Isoelectric Point: 5.5

Core Sequence: YDYSALSCTSDASFHPAFLPQRQAIKGAFYRRAQRLRPQDEPRQGCQPEDRRRRIIINVGGIKYSLPWTTLDEFPLTRLGQLKACTNFDDILNVCDDYDVTCNEFFFDRNPGAFGTILTFLRAGKLRLLREMCALSFQEELLYWGIAEDHLDGCCKRRYLQKIEEFAEMVEREEEDDALDSEGRDSEGPAEGEGRLGRCMRRLRDMVERP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 89%, Rat - 88%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Potassium voltage-gated channel subfamily G member 1; Voltage-gated potassium channel subunit Kv6.1; kH2

Protein name: potassium voltage-gated channel modifier subfamily G member 1

Full length: 513 amino acids

Entry name: KCNG1_HUMAN
More Information
SKU ASBPP-3201-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3201-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3755
Product information (PDF)
×
MSDS (PDF)
×