Recombinant Human KCNJ1 Protein

Recombinant Human KCNJ1 Protein
SKU
ASBPP-4217-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48048

Gene Name: KCNJ1

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Thr241

End Site: Leu320

Coverage: 0.22

Isoelectric Point: 4.5

Core Sequence: TIILDQININFVVDAGNENLFFISPLTIYHVIDHNSPFFHMAAETLLQQDFELVVFLDGTVESTSATCQVRTSYVPEEVL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 95%, Pig - 95%, Cynomolgus monkey - 99%

Alternative gene names: ROMK1

Alternative protein names: ATP-sensitive inward rectifier potassium channel 1; ATP-regulated potassium channel ROM-K; Inward rectifier K(+) channel Kir1.1; Potassium channel; inwardly rectifying subfamily J member 1

Protein name: potassium inwardly rectifying channel subfamily J member 1

Full length: 391 amino acids

Entry name: KCNJ1_HUMAN
More Information
SKU ASBPP-4217-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4217-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3758
Product information (PDF)
×
MSDS (PDF)
×