Recombinant Human KCNJ10 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P78508

Gene Name: KCNJ10

Expression System: Escherichia coli

Molecular Weight: 17.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu231

End Site: Ser370

Coverage: 0.39

Isoelectric Point: 4.5

Core Sequence: LNQVNVTFQVDTASDSPFLILPLTFYHVVDETSPLKDLPLRSGEGDFELVLILSGTVESTSATCQVRTSYLPEEILWGYEFTPAISLSASGKYIADFSLFDQVVKVASPSGLRDSTVRYGDPEKLKLEESLREQAEKEGS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: ATP-sensitive inward rectifier potassium channel 10; ATP-dependent inwardly rectifying potassium channel Kir4.1; Inward rectifier K(+) channel Kir1.2; Potassium channel; inwardly rectifying subfamily J member 10

Protein name: potassium inwardly rectifying channel subfamily J member 10

Full length: 379 amino acids

Entry name: KCJ10_HUMAN

• SKU: ASBPP-353-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-353-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3766