Recombinant Human KCNJ14 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9UNX9

Gene Name: KCNJ14

Expression System: Escherichia coli

Molecular Weight: 20.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Gly261

End Site: Ala420

Coverage: 0.39

Isoelectric Point: 4.5

Core Sequence: GGTDRIFLVSPITIVHEIDSASPLYELGRAELARADFELVVILEGMVEATAMTTQCRSSYLPGELLWGHRFEPVLFQRGSQYEVDYRHFHRTYEVPGTPVCSAKELDERAEQASHSLKSSFPGSLTAFCYENELALSCCQEEDEDDETEEGNGVETEDGA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: IRK4

Alternative protein names: ATP-sensitive inward rectifier potassium channel 14; Inward rectifier K(+) channel Kir2.4; IRK-4; Potassium channel; inwardly rectifying subfamily J member 14

Protein name: potassium inwardly rectifying channel subfamily J member 14

Full length: 436 amino acids

Entry name: KCJ14_HUMAN

• SKU: ASBPP-2941-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2941-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3770