Recombinant Human KCNJ4 Protein

Recombinant Human KCNJ4 Protein
SKU
ASBPP-297-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48050

Gene Name: KCNJ4

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Glu231

End Site: Ser310

Coverage: 0.18

Isoelectric Point: 4

Core Sequence: EGEYLPLDQRDLNVGYDIGLDRIFLVSPIIIVHEIDEDSPLYGMGKEELESEDFEIVVILEGMVEATAMTTQARSSYLAS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: IRK3

Alternative protein names: Inward rectifier potassium channel 4; HIRK2; HRK1; Hippocampal inward rectifier; HIR; Inward rectifier K(+) channel Kir2.3; IRK-3; Potassium channel; inwardly rectifying subfamily J member 4

Protein name: potassium inwardly rectifying channel subfamily J member 4

Full length: 445 amino acids

Entry name: KCNJ4_HUMAN
More Information
SKU ASBPP-297-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-297-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 3761
Product information (PDF)
×
MSDS (PDF)
×