Recombinant Human KCNK4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9NYG8

Gene Name: KCNK4

Expression System: Escherichia coli

Molecular Weight: 15.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 82%

Start Site: Leu271

End Site: Gly390

Coverage: 0.33

Isoelectric Point: 11.5

Core Sequence: LTAQAASWTGTVTARVTQRAGPAAPPPEKEQPLLPPPPCPAQPLGRPRSPSPPEKAQPPSPPTASALDYPSENLAFIDESSDTQSERGCPLPRAPRGRRRPNPPRKPVRPRGPGRPRDKG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 82%, Rat - 81%, Pig - 88%, Cynomolgus monkey - 88%

Alternative gene names: TRAAK

Alternative protein names: Potassium channel subfamily K member 4; TWIK-related arachidonic acid-stimulated potassium channel protein; TRAAK; Two pore potassium channel KT4.1; Two pore K(+) channel KT4.1

Protein name: potassium two pore domain channel subfamily K member 4

Full length: 393 amino acids

Entry name: KCNK4_HUMAN

• SKU: ASBPP-4276-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4276-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 50801