Recombinant Human KCNQ1 Protein

Recombinant Human KCNQ1 Protein
SKU
ASBPP-310-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P51787

Gene Name: KCNQ1

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Thr391

End Site: Gly460

Coverage: 0.12

Isoelectric Point: 10

Core Sequence: TWKIYIRKAPRSHTLLSPSPKPKKSVVVKKKKFKLDKDNGVTPGEKMLTVPHITCDPPEERRLDHFSVDG

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 85%, Pig - 78%, Cynomolgus monkey - 93%

Alternative gene names: KCNA8; KCNA9; KVLQT1

Alternative protein names: Potassium voltage-gated channel subfamily KQT member 1; IKs producing slow voltage-gated potassium channel subunit alpha KvLQT1; KQT-like 1; Voltage-gated potassium channel subunit Kv7.1

Protein name: potassium voltage-gated channel subfamily Q member 1

Full length: 676 amino acids

Entry name: KCNQ1_HUMAN
More Information
SKU ASBPP-310-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-310-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3784
Product information (PDF)
×
MSDS (PDF)
×