Recombinant Human KCTD1 Protein

Recombinant Human KCTD1 Protein
SKU
ASBPP-10395-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q719H9

Gene Name: KCTD1

Expression System: Escherichia coli

Molecular Weight: 19 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Thr21

End Site: Glu170

Coverage: 0.60

Isoelectric Point: 6.5

Core Sequence: TPAQLTKSNAPVHIDVGGHMYTSSLATLTKYPESRIGRLFDGTEPIVLDSLKQHYFIDRDGQMFRYILNFLRTSKLLIPDDFKDYTLLYEEAKYFQLQPMLLEMERWKQDRETGRFSRPCECLVVRVAPDLGERITLSGDKSLIEEVFPE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 99%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: C18orf5

Alternative protein names: BTB/POZ domain-containing protein KCTD1; Potassium channel tetramerization domain-containing protein 1

Protein name: potassium channel tetramerization domain containing 1

Full length: 257 amino acids

Entry name: KCTD1_HUMAN
More Information
SKU ASBPP-10395-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10395-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 284252
Product information (PDF)
×
MSDS (PDF)
×