Recombinant Human KDM4B Protein

Note: Dry Ice fees will be extra-charged

Uniprot: O94953

Gene Name: KDM4B

Expression System: Escherichia coli

Molecular Weight: 10.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Ser601

End Site: Glu670

Coverage: 0.07

Isoelectric Point: 10

Core Sequence: SKLKMEIKKSRRHPLGRPPTRSPLSVVKQEASSDEEASPFSGEEDVSDPDALRPLLSLQWKNRAASFQAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Pig - 90%, Cynomolgus monkey - 99%

Alternative gene names: JHDM3B; JMJD2B; KIAA0876

Alternative protein names: Lysine-specific demethylase 4B; JmjC domain-containing histone demethylation protein 3B; Jumonji domain-containing protein 2B; [histone H3]-trimethyl-L-lysine(9) demethylase 4B

Protein name: lysine demethylase 4B

Full length: 1096 amino acids

Entry name: KDM4B_HUMAN

Product panel: DNA binding & Chromatin,Enzyme

• SKU: ASBPP-3112-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3112-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 23030