Recombinant Human KDM5C Protein

Recombinant Human KDM5C Protein
SKU
ASBPP-3103-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P41229

Gene Name: KDM5C

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Glu1401

End Site: Glu1500

Coverage: 0.07

Isoelectric Point: 4.5

Core Sequence: ELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLELEKAERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Pig - 96%, Cynomolgus monkey - 100%

Alternative gene names: DXS1272E; JARID1C; SMCX; XE169

Alternative protein names: Lysine-specific demethylase 5C; Histone demethylase JARID1C; Jumonji/ARID domain-containing protein 1C; Protein SmcX; Protein Xe169; [histone H3]-trimethyl-L-lysine(4) demethylase 5C

Protein name: lysine demethylase 5C

Full length: 1560 amino acids

Entry name: KDM5C_HUMAN

Product panel: DNA binding & Chromatin,Enzyme
More Information
SKU ASBPP-3103-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3103-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8242
Product information (PDF)
×
MSDS (PDF)
×