Recombinant Human KLF11 Protein

Recombinant Human KLF11 Protein
SKU
ASBPP-3179-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O14901

Gene Name: KLF11

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 62%

Start Site: Val81

End Site: Ser200

Coverage: 0.25

Isoelectric Point: 5.5

Core Sequence: VTTTVHMDAATPELPKDFHSLSTLCITPPQSPDLVEPSTRTPVSPQVTDSKACTATDVLQSSAVVARALSGGAERGLLGLEPVPSSPCRAKGTSVIRHTGESPAACFPTIQTPDCRLSDS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 62%, Pig - 56%, Cynomolgus monkey - 92%

Alternative gene names: FKLF; TIEG2

Alternative protein names: Krueppel-like factor 11; Transforming growth factor-beta-inducible early growth response protein 2; TGFB-inducible early growth response protein 2; TIEG-2

Protein name: KLF transcription factor 11

Full length: 512 amino acids

Entry name: KLF11_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3179-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3179-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8462
Product information (PDF)
×
MSDS (PDF)
×