Recombinant Human KLF14 Protein

Recombinant Human KLF14 Protein
SKU
ASBPP-3180-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TD94

Gene Name: KLF14

Expression System: Escherichia coli

Molecular Weight: 11.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 79%

Start Site: Leu171

End Site: Thr250

Coverage: 0.29

Isoelectric Point: 10

Core Sequence: LGAGPAPAADQAPRRRSVTPAAKRHQCPFPGCTKAYYKSSHLKSHQRTHTGERPFSCDWLDCDKKFTRSDELARHYRTHT

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 79%, Rat - 72%, Pig - 87%, Cynomolgus monkey - 72%

Alternative gene names: BTEB5

Alternative protein names: Krueppel-like factor 14; Basic transcription element-binding protein 5; BTE-binding protein 5; Transcription factor BTEB5

Protein name: KLF transcription factor 14

Full length: 323 amino acids

Entry name: KLF14_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3180-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3180-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 136259
Product information (PDF)
×
MSDS (PDF)
×