Recombinant Human KLK5 Protein

Recombinant Human KLK5 Protein
SKU
ASBPP-3223-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y337

Gene Name: KLK5

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Val23

End Site: Ser293

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 47%, Pig - 76%, Cynomolgus monkey - 92%

Alternative gene names: SCTE

Alternative protein names: Kallikrein-5; Kallikrein-like protein 2; KLK-L2; Stratum corneum tryptic enzyme

Protein name: kallikrein related peptidase 5

Full length: 293 amino acids

Entry name: KLK5_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3223-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3223-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 25818
Product information (PDF)
×
MSDS (PDF)
×