Recombinant Human KLK5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y337

Gene Name: KLK5

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 50%

Start Site: Val23

End Site: Ser293

Coverage: 1.00

Isoelectric Point: 8

Core Sequence: VTEHVLANNDVSCDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAALLLRPNQLYCGAVLVHPQWLLTAAHCRKKVFRVRLGHYSLSPVYESGQQMFQGVKSIPHPGYSHPGHSNDLMLIKLNRRIRPTKDVRPINVSSHCPSAGTKCLVSGWGTTKSPQVHFPKVLQCLNISVLSQKRCEDAYPRQIDDTMFCAGDKAGRDSCQGDSGGPVVCNGSLQGLVSWGDYPCARPNRPGVYTNLCKFTKWIQETIQANS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 50%, Rat - 47%, Pig - 76%, Cynomolgus monkey - 92%

Alternative gene names: SCTE

Alternative protein names: Kallikrein-5; Kallikrein-like protein 2; KLK-L2; Stratum corneum tryptic enzyme

Protein name: kallikrein related peptidase 5

Full length: 293 amino acids

Entry name: KLK5_HUMAN

Product panel: Enzyme

• SKU: ASBPP-3223-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3223-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 25818