Note: Dry Ice fees will be extra-charged
Uniprot: Q86Y97
Gene Name: KMT5C
Expression System: Escherichia coli
Molecular Weight: 15.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 97%
Start Site: Leu101
End Site: Gly220
Coverage: 0.27
Isoelectric Point: 6.5
Core Sequence: LPESGFTILPCTRYSMETNGAKIVSTRAWKKNEKLELLVGCIAELREADEGLLRAGENDFSIMYSTRKRSAQLWLGPAAFINHDCKPNCKFVPADGNAACVKVLRDIEPGDEVTCFYGEG
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 97%, Rat - 96%, Pig - 100%, Cynomolgus monkey - 99%
Alternative gene names: SUV420H2
Alternative protein names: Histone-lysine N-methyltransferase KMT5C; Lysine N-methyltransferase 5C; Lysine-specific methyltransferase 5C; Suppressor of variegation 4-20 homolog 2; Su(var)4-20 homolog 2; Suv4-20h2; [histone H4]-N-methyl-L-lysine20 N-methyltransferase KMT5B; [histone H4]-lysine20 N-methyltransferase KMT5B
Protein name: lysine methyltransferase 5C
Full length: 462 amino acids
Entry name: KMT5C_HUMAN
Product panel: DNA binding & Chromatin,Enzyme
English
Deutsch
