Recombinant Human KPNA7 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: A9QM74

Gene Name: KPNA7

Expression System: Escherichia coli

Molecular Weight: 30 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 53%

Start Site: Ala261

End Site: Tyr510

Coverage: 0.50

Isoelectric Point: 4.5

Core Sequence: ACWALSYLTDGSNKRIGQVVNTGVLPRLVVLMTSSELNVLTPSLRTVGNIVTGTDEQTQMAIDAGMLNVLPQLLQHNKPSIQKEAAWALSNVAAGPCHHIQQLLAYDVLPPLVALLKNGEFKVQKEAVWMVANFATGATMDQLIQLVHSGVLEPLVNLLTAPDVKIVLIILDVISCILQAAEKRSEKENLCLLIEELGGIDRIEALQLHENRQIGQSALNIIEKHFGEEEDESQTLLSQVIDQDYEFIDY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 53%, Rat - 42%, Pig - 74%, Cynomolgus monkey - 95%

Alternative gene names: /

Alternative protein names: Importin subunit alpha-8; Karyopherin subunit alpha-7

Protein name: karyopherin subunit alpha 7

Full length: 516 amino acids

Entry name: IMA8_HUMAN

• SKU: ASBPP-10373-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-10373-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 402569