Note: Dry Ice fees will be extra-charged
Uniprot: P01116
Gene Name: KRAS
Expression System: Escherichia coli
Molecular Weight: 13.5 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Glu31
End Site: Ala130
Coverage: 0.56
Isoelectric Point: 5
Core Sequence: EYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQA
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: KRAS2; RASK2
Alternative protein names: GTPase KRas; K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras) [Cleaved into: GTPase KRas; N-terminally processed]
Protein name: KRAS proto-oncogene, GTPase
Full length: 189 amino acids
Entry name: RASK_HUMAN
Product panel: Enzyme
English
Deutsch
