Note: Dry Ice fees will be extra-charged
Uniprot: P01116
Gene Name: KRAS
Expression System: Escherichia coli
Molecular Weight: 22 kDa
Purity: ≥85%
Formulation: Phosphate buffered saline
Tag: C-His
Modification: unmodified
Species: Human
Identity-Mouse (%): 99%
Start Site: Ala11
End Site: Cys180
Coverage: 0.98
Isoelectric Point: 7.5
Core Sequence: AGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC
Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%
Alternative gene names: KRAS2; RASK2
Alternative protein names: GTPase KRas; K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras) [Cleaved into: GTPase KRas; N-terminally processed]
Protein name: KRAS proto-oncogene, GTPase
Full length: 189 amino acids
Entry name: RASK_HUMAN
Product panel: Enzyme
English
Deutsch
