Recombinant Human KRAS Protein

Recombinant Human KRAS Protein
SKU
ASBPP-4350-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P01116

Gene Name: KRAS

Expression System: Escherichia coli

Molecular Weight: 22 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Ala11

End Site: Cys180

Coverage: 0.98

Isoelectric Point: 7.5

Core Sequence: AGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRLKKISKEEKTPGC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 99%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: KRAS2; RASK2

Alternative protein names: GTPase KRas; K-Ras 2; Ki-Ras; c-K-ras; c-Ki-ras) [Cleaved into: GTPase KRas; N-terminally processed]

Protein name: KRAS proto-oncogene, GTPase

Full length: 189 amino acids

Entry name: RASK_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-4350-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4350-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 3845
Product information (PDF)
×
MSDS (PDF)
×