Recombinant Human KRT222 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8N1A0

Gene Name: KRT222

Expression System: Escherichia coli

Molecular Weight: 14.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 86%

Start Site: Lys161

End Site: Leu270

Coverage: 0.40

Isoelectric Point: 6.5

Core Sequence: KKPTTSRVGFVLPSAIINEISFTTKVPQKYENENVETVTKQAILNGSIVKESTEAHGTIQTEKVDEVIKEWEGSFFKDNPRLRKKSVSLRFDLHLAATDEGCLETKQDNL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 86%, Pig - 95%, Cynomolgus monkey - 97%

Alternative gene names: KA21; KRT222P

Alternative protein names: Keratin-like protein KRT222; Keratin-222; Keratin-222 pseudogene

Protein name: keratin 222

Full length: 295 amino acids

Entry name: KT222_HUMAN

• SKU: ASBPP-3263-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3263-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 125113