Recombinant Human Cytokeratin-4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P19013

Gene Name: KRT4

Expression System: Escherichia coli

Molecular Weight: 27.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 84%

Start Site: Tyr191

End Site: Gln410

Coverage: 0.44

Isoelectric Point: 5

Core Sequence: YLSVLRKQLDTLGNDKGRLQSELKTMQDSVEDFKTKYEEEINKRTAAENDFVVLKKDVDAAYLNKVELEAKVDSLNDEINFLKVLYDAELSQMQTHVSDTSVVLSMDNNRNLDLDSIIAEVRAQYEEIAQRSKAEAEALYQTKVQQLQISVDQHGDNLKNTKSEIAELNRMIQRLRAEIENIKKQCQTLQVSVADAEQRGENALKDAHSKRVELEAALQQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 84%, Rat - 83%, Pig - 89%, Cynomolgus monkey - 98%

Alternative gene names: CYK4

Alternative protein names: Keratin; type II cytoskeletal 4; Cytokeratin-4; CK-4; Keratin-4; K4; Type-II keratin Kb4

Protein name: keratin 4

Full length: 520 amino acids

Entry name: K2C4_HUMAN

• SKU: ASBPP-4146-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4146-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3851