Recombinant Human Cytokeratin-6C Protein

Recombinant Human Cytokeratin-6C Protein
SKU
ASBPP-4189-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P48668

Gene Name: KRT6C

Expression System: Escherichia coli

Molecular Weight: 37.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Asn171

End Site: Glu470

Coverage: 0.55

Isoelectric Point: 5

Core Sequence: NNKFASFIDKVRFLEQQNKVLDTKWTLLQEQGTKTVRQNLEPLFEQYINNLRRQLDSIVGERGRLDSELRNMQDLVEDLKNKYEDEINKRTAAENEFVTLKKDVDAAYMNKVELQAKADTLTDEINFLRALYDAELSQMQTHISDTSVVLSMDNNRNLDLDSIIAEVKAQYEEIAQRSRAEAESWYQTKYEELQVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCASLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 91%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: KRT6E

Alternative protein names: Keratin; type II cytoskeletal 6C; Cytokeratin-6C; CK-6C; Cytokeratin-6E; CK-6E; Keratin K6h; Keratin-6C; K6C; Type-II keratin Kb12

Protein name: keratin 6C

Full length: 564 amino acids

Entry name: K2C6C_HUMAN

Product panel: IHC Pathology
More Information
SKU ASBPP-4189-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4189-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 286887
Product information (PDF)
×
MSDS (PDF)
×