Recombinant Human L3MBTL2 Protein

Recombinant Human L3MBTL2 Protein
SKU
ASBPP-10414-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q969R5

Gene Name: L3MBTL2

Expression System: Escherichia coli

Molecular Weight: 15 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 74%

Start Site: Val581

End Site: Lys700

Coverage: 0.17

Isoelectric Point: 9.5

Core Sequence: VDCESPDIYPVGWCELTGYQLQPPVAAEPATPLKAKEATKKKKKQFGKKRKRIPPTKTRPLRQGSKKPLLEDDPQGARKISSEPVPGEIIAVRVKEEHLDVASPDKASSPELPVSVENIK

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 74%, Rat - 75%, Pig - 90%, Cynomolgus monkey - 96%

Alternative gene names: /

Alternative protein names: Lethal(3)malignant brain tumor-like protein 2; H-l(3)mbt-like protein 2; L(3)mbt-like protein 2

Protein name: L3MBTL histone methyl-lysine binding protein 2

Full length: 705 amino acids

Entry name: LMBL2_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-10414-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-10414-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 83746
Product information (PDF)
×
MSDS (PDF)
×