Recombinant Human LANCL1 Protein

Recombinant Human LANCL1 Protein
SKU
ASBPP-3915-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O43813

Gene Name: LANCL1

Expression System: Escherichia coli

Molecular Weight: 42.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 91%

Start Site: Ala11

End Site: Asn260

Coverage: 0.66

Isoelectric Point: 7.5

Core Sequence: ADYNKSLAEGYFDAAGRLTPEFSQRLTNKIRELLQQMERGLKSADPRDGTGYTGWAGIAVLYLHLYDVFGDPAYLQLAHGYVKQSLNCLTKRSITFLCGDAGPLAVAAVLYHKMNNEKQAEDCITRLIHLNKIDPHAPNEMLYGRIGYIYALLFVNKNFGVEKIPQSHIQQICETILTSGENLARKRNFTAKSPLMYEWYQEYYVGAAHGLAGIYYYLMQPSLQVSQGKLHSLVKPSVDYVCQLKFPSGN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 91%, Rat - 90%, Pig - 92%, Cynomolgus monkey - 100%

Alternative gene names: GPR69A

Alternative protein names: Glutathione S-transferase LANCL1; 40 kDa erythrocyte membrane protein; p40; LanC-like protein 1

Protein name: LanC like glutathione S-transferase 1

Full length: 399 amino acids

Entry name: LANC1_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3915-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3915-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 10314
Product information (PDF)
×
MSDS (PDF)
×