Recombinant Human LBX1 Protein

Recombinant Human LBX1 Protein
SKU
ASBPP-4162-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P52954

Gene Name: LBX1

Expression System: Escherichia coli

Molecular Weight: 21 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 96%

Start Site: Asp111

End Site: Asp280

Coverage: 0.64

Isoelectric Point: 6.5

Core Sequence: DGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSGQMDIVALAELEQNSEATAGGGGGCGRAKSRPGSPVLPPGAPKAPGAGALQLSPASPLTDQPASSQDCSEDEEDEEIDVD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 96%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 96%

Alternative gene names: LBX1H

Alternative protein names: Transcription factor LBX1; Ladybird homeobox protein homolog 1

Protein name: ladybird homeobox 1

Full length: 281 amino acids

Entry name: LBX1_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-4162-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-4162-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 10660
Product information (PDF)
×
MSDS (PDF)
×