Recombinant Human LCN1P1 Protein

Recombinant Human LCN1P1 Protein
SKU
ASBPP-3253-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q5VSP4

Gene Name: LCN1P1

Expression System: Escherichia coli

Molecular Weight: 14 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 40%

Start Site: Val31

End Site: Ala130

Coverage: 0.79

Isoelectric Point: 5

Core Sequence: VSGTWYLKAMTVDRELPEMNLESVTPMTLTILEGGNLEAKATMLISGQCQEVKVILEKTDEPGKYTANRGKHVAYIIRSHMKDHYIFYCEGRDPENNLEA

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 40%, Rat - 57%, Pig - 53%, Cynomolgus monkey - 84%

Alternative gene names: LCN1L1

Alternative protein names: Putative lipocalin 1-like protein 1; Lipocalin 1-like pseudogene 1

Protein name: lipocalin 1 pseudogene 1

Full length: 162 amino acids

Entry name: LC1L1_HUMAN
More Information
SKU ASBPP-3253-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3253-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 286310
Product information (PDF)
×
MSDS (PDF)
×