Recombinant Human LEMD2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8NC56

Gene Name: LEMD2

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Glu241

End Site: Ser370

Coverage: 0.28

Isoelectric Point: 6

Core Sequence: EAEDNMKLLPVDCERKTDEFCQAKQKAALLELLHELYNFLAIQAGNFECGNPENLKSKCIPVMEAQEYIANVTSSSSAKFEAALTWILSSNKDVGIWLKGEDQSELVTTVDKVVCLESAHPRMGVGCRLS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Pig - 94%, Cynomolgus monkey - 98%

Alternative gene names: /

Alternative protein names: LEM domain-containing protein 2; hLEM2

Protein name: LEM domain nuclear envelope protein 2

Full length: 503 amino acids

Entry name: LEMD2_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3252-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3252-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 221496