Recombinant Human LEMD3 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y2U8

Gene Name: LEMD3

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 70%

Start Site: Ser261

End Site: Asn360

Coverage: 0.12

Isoelectric Point: 6.5

Core Sequence: SEEEDDDDVASSRQVLKDDSLSRHRPRRTHSKPLPPLTAKSAGGRLETSVQGGGGLAMNDRAAAAGSLDRSRNLEEAAAAEQGGGCDQVDSSPVPRYRVN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 70%, Pig - 91%, Cynomolgus monkey - 96%

Alternative gene names: MAN1

Alternative protein names: Inner nuclear membrane protein Man1; LEM domain-containing protein 3

Protein name: LEM domain containing 3

Full length: 911 amino acids

Entry name: MAN1_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-442-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-442-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 23592