Recombinant Human LEP Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P41159

Gene Name: LEP

Expression System: Escherichia coli

Molecular Weight: 58.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 85%

Start Site: Val22

End Site: Cys167

Coverage: 1.00

Isoelectric Point: 5.5

Core Sequence: VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAVYQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPWASGLETLDSLGGVLEASGYSTEVVALSRLQGSLQDMLWQLDLSPGC

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 85%, Rat - 84%, Pig - 87%, Cynomolgus monkey - 91%

Alternative gene names: OB; OBS

Alternative protein names: Leptin; Obese protein; Obesity factor

Protein name: leptin

Full length: 167 amino acids

Entry name: LEP_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3129-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3129-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 3952