Recombinant Human LGALS13 Protein

Recombinant Human LGALS13 Protein
SKU
ASBPP-3411-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UHV8

Gene Name: LGALS13

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 37%

Start Site: Met1

End Site: Asn139

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MSSLPVPYKLPVSLSVGSCVIIKGTPIHSFINDPQLQVDFYTDMDEDSDIAFRFRVHFGNHVVMNRREFGIWMLEETTDYVPFEDGKQFELCIYVHYNEYEIKVNGIRIYGFVHRIPPSFVKMVQVSRDISLTSVCVCN

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 37%, Rat - 37%, Pig - 53%, Cynomolgus monkey - 96%

Alternative gene names: PLAC8

Alternative protein names: Galactoside-binding soluble lectin 13; Galectin-13; Gal-13; Placental tissue protein 13; PP13; Placental protein 13

Protein name: galectin 13

Full length: 139 amino acids

Entry name: PP13_HUMAN
More Information
SKU ASBPP-3411-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3411-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 29124
Product information (PDF)
×
MSDS (PDF)
×