Recombinant Human LGALS14 Protein

Recombinant Human LGALS14 Protein
SKU
ASBPP-3239-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q8TCE9

Gene Name: LGALS14

Expression System: Escherichia coli

Molecular Weight: 17 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 54%

Start Site: Met1

End Site: Asp139

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: MSSLPVPYTLPVSLPVGSCVIITGTPILTFVKDPQLEVNFYTGMDEDSDIAFQFRLHFGHPAIMNSCVFGIWRYEEKCYYLPFEDGKPFELCIYVRHKEYKVMVNGQRIYNFAHRFPPASVKMLQVFRDISLTRVLISD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 54%, Rat - 37%, Pig - 53%, Cynomolgus monkey - 97%

Alternative gene names: PPL13

Alternative protein names: Placental protein 13-like; Charcot-Leyden crystal protein 2; CLC2; Galectin-14; Gal-14

Protein name: galectin 14

Full length: 139 amino acids

Entry name: PPL13_HUMAN
More Information
SKU ASBPP-3239-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3239-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 56891
Product information (PDF)
×
MSDS (PDF)
×