Recombinant Human LHB Protein

Note: Dry Ice fees will be extra-charged

Uniprot: P01229

Gene Name: LHB

Expression System: Escherichia coli

Molecular Weight: 25.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & N-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 72%

Start Site: Ser21

End Site: Leu141

Coverage: 1.00

Isoelectric Point: 7

Core Sequence: SREPLRPWCHPINAILAVEKEGCPVCITVNTTICAGYCPTMMRVLQAVLPPLPQVVCTYRDVRFESIRLPGCPRGVDPVVSFPVALSCRCGPCRRSTSDCGGPKDHPLTCDHPQLSGLLFL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 72%, Rat - 72%, Pig - 74%, Cynomolgus monkey - 87%

Alternative gene names: /

Alternative protein names: Lutropin subunit beta; Lutropin beta chain; Luteinizing hormone subunit beta; LH-B; LSH-B; LSH-beta

Protein name: luteinizing hormone subunit beta

Full length: 141 amino acids

Entry name: LSHB_HUMAN

Product panel: IHC Pathology

• SKU: ASBPP-3073-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3073-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 3972