Recombinant Human LHX5 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9H2C1

Gene Name: LHX5

Expression System: Escherichia coli

Molecular Weight: 13.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Ser161

End Site: Pro260

Coverage: 0.26

Isoelectric Point: 12

Core Sequence: SSDKETANNENEEQNSGTKRRGPRTTIKAKQLETLKAAFAATPKPTRHIREQLAQETGLNMRVIQVWFQNRRSKERRMKQLSALGARRHAFFRSPRRMRP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: LIM/homeobox protein Lhx5; LIM homeobox protein 5

Protein name: LIM homeobox 5

Full length: 402 amino acids

Entry name: LHX5_HUMAN

Product panel: DNA binding & Chromatin

• SKU: ASBPP-3350-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3350-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64211