Recombinant Human LHX6 Protein

Recombinant Human LHX6 Protein
SKU
ASBPP-3746-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9UPM6

Gene Name: LHX6

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 99%

Start Site: Asn191

End Site: Pro290

Coverage: 0.28

Isoelectric Point: 10.5

Core Sequence: NLKRAAENGNGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTGLSRRVIQVWFQNCRARHKKHTPQHPVPPSGAPP

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 99%, Rat - 49%, Pig - 100%

Alternative gene names: LHX6.1

Alternative protein names: LIM/homeobox protein Lhx6; LIM homeobox protein 6; LIM/homeobox protein Lhx6.1

Protein name: LIM homeobox 6

Full length: 363 amino acids

Entry name: LHX6_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3746-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3746-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 26468
Product information (PDF)
×
MSDS (PDF)
×