Recombinant Human LHX8 Protein

Recombinant Human LHX8 Protein
SKU
ASBPP-3258-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q68G74

Gene Name: LHX8

Expression System: Escherichia coli

Molecular Weight: 12.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Gly211

End Site: Ser300

Coverage: 0.28

Isoelectric Point: 10.5

Core Sequence: GALLTEQDVNHPKPAKRARTSFTADQLQVMQAQFAQDNNPDAQTLQKLAERTGLSRRVIQVWFQNCRARHKKHVSPNHSSSTPVTAVPPS

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 48%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: LIM/homeobox protein Lhx8; LIM homeobox protein 8

Protein name: LIM homeobox 8

Full length: 356 amino acids

Entry name: LHX8_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-3258-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3258-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 431707
Product information (PDF)
×
MSDS (PDF)
×