Recombinant Human LIN7B Protein

Recombinant Human LIN7B Protein
SKU
ASBPP-3755-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: Q9HAP6

Gene Name: LIN7B

Expression System: Escherichia coli

Molecular Weight: 23.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 98%

Start Site: Glu11

End Site: Tyr200

Coverage: 0.96

Isoelectric Point: 8

Core Sequence: ERDVSRAVELLERLQRSGELPPQKLQALQRVLQSRFCSAIREVYEQLYDTLDITGSAEIRAHATAKATVAAFTASEGHAHPRVVELPKTDEGLGFNIMGGKEQNSPIYISRVIPGGVADRHGGLKRGDQLLSVNGVSVEGEQHEKAVELLKAAQGSVKLVVRYTPRVLEEMEARFEKMRSARRRQQHQSY

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 98%, Rat - 99%, Pig - 100%

Alternative gene names: MALS2; VELI2

Alternative protein names: Protein lin-7 homolog B; Lin-7B; hLin7B; Mammalian lin-seven protein 2; MALS-2; Vertebrate lin-7 homolog 2; Veli-2; hVeli2

Protein name: lin-7 homolog B, crumbs cell polarity complex component

Full length: 207 amino acids

Entry name: LIN7B_HUMAN
More Information
SKU ASBPP-3755-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3755-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 64130
Product information (PDF)
×
MSDS (PDF)
×