Recombinant Human LMO4 Protein

Recombinant Human LMO4 Protein
SKU
ASBPP-331-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P61968

Gene Name: LMO4

Expression System: Escherichia coli

Molecular Weight: 57.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-MBP & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Lys21

End Site: Leu150

Coverage: 0.84

Isoelectric Point: 6.5

Core Sequence: KRCAGCGGKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLFGNSGACSACGQSIPASELVMRAQGNVYHLKCFTCSTCRNRLVPGDRFHYINGSLFCEHDRPTALINGHL

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Rat - 53%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: LIM domain transcription factor LMO4; Breast tumor autoantigen; LIM domain only protein 4; LMO-4

Protein name: LIM domain only 4

Full length: 165 amino acids

Entry name: LMO4_HUMAN

Product panel: DNA binding & Chromatin
More Information
SKU ASBPP-331-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-331-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 8543
Product information (PDF)
×
MSDS (PDF)
×