Recombinant Human LRP2 Protein

Recombinant Human LRP2 Protein
SKU
ASBPP-356-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P98164

Gene Name: LRP2

Expression System: Escherichia coli

Molecular Weight: 11 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 65%

Start Site: Ser4531

End Site: Gln4600

Coverage: 0.01

Isoelectric Point: 6.5

Core Sequence: SAVKVVQPIQVTVSENVDNKNYGSPINPSEIVPETNPTSPAADGTQVTKWNLFKRKSKQTTNFENPIYAQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 65%, Rat - 61%, Pig - 64%, Cynomolgus monkey - 93%

Alternative gene names: /

Alternative protein names: Low-density lipoprotein receptor-related protein 2; LRP-2; Glycoprotein 330; gp330; Megalin

Protein name: LDL receptor related protein 2

Full length: 4655 amino acids

Entry name: LRP2_HUMAN
More Information
SKU ASBPP-356-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-356-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4036
Product information (PDF)
×
MSDS (PDF)
×