Recombinant Human LRP4 Protein

Recombinant Human LRP4 Protein
SKU
ASBPP-033-100
Packaging Unit
100 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: O75096

Gene Name: LRP4

Expression System: Escherichia coli

Molecular Weight: 12 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 93%

Start Site: Ile1781

End Site: Gln1870

Coverage: 0.05

Isoelectric Point: 5.5

Core Sequence: IPKPAMYNQLCYKKEGGPDHNYTKEKIKIVEGICLLSGDDAEWDDLKQLRSSRGGLLRDHVCMKTDTVSIQASSGSLDDTETEQLLQEEQ

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 93%, Rat - 94%, Pig - 97%, Cynomolgus monkey - 100%

Alternative gene names: KIAA0816; LRP10; MEGF7

Alternative protein names: Low-density lipoprotein receptor-related protein 4; LRP-4; Multiple epidermal growth factor-like domains 7

Protein name: LDL receptor related protein 4

Full length: 1905 amino acids

Entry name: LRP4_HUMAN
More Information
SKU ASBPP-033-100
Manufacturer Absea Biotechnology
Manufacturer SKU PP-033-100
Package Unit 100 μg
Quantity Unit STK
Human Gene ID 4038
Product information (PDF)
×
MSDS (PDF)
×