Recombinant Human LRRC4 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9HBW1

Gene Name: LRRC4

Expression System: Escherichia coli

Molecular Weight: 32 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 95%

Start Site: Asp361

End Site: Asp520

Coverage: 0.28

Isoelectric Point: 6.5

Core Sequence: DLNISEGRMAELKCRTPPMSSVKWLLPNGTVLSHASRHPRISVLNDGTLNFSHVLLSDTGVYTCMVTNVAGNSNASAYLNVSTAELNTSNYSFFTTVTVETTEISPEDTTRKYKPVPTTSTGYQPAYTTSTTVLIQTTRVPKQVAVPATDTTDKMQTSLD

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 95%, Rat - 95%, Pig - 99%, Cynomolgus monkey - 100%

Alternative gene names: BAG

Alternative protein names: Leucine-rich repeat-containing protein 4; Brain tumor-associated protein BAG; Nasopharyngeal carcinoma-associated gene 14 protein; Netrin-G2 ligand; NGL-2

Protein name: leucine rich repeat containing 4

Full length: 653 amino acids

Entry name: LRRC4_HUMAN

• SKU: ASBPP-3069-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3069-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 64101