Recombinant Human LRRTM1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q86UE6

Gene Name: LRRTM1

Expression System: Escherichia coli

Molecular Weight: 18.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 94%

Start Site: Met271

End Site: Glu420

Coverage: 0.33

Isoelectric Point: 4.5

Core Sequence: MEPHVFETVPHLQSLQLDSNRLTYIEPRILNSWKSLTSITLAGNLWDCGRNVCALASWLNNFQGRYDGNLQCASPEYAQGEDVLDAVYAFHLCEDGAEPTSGHLLSAVTNRSDLGPPASSATTLADGGEGQHDGTFEPATVALPGGEHAE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 94%, Rat - 93%, Pig - 94%, Cynomolgus monkey - 99%

Alternative gene names: /

Alternative protein names: Leucine-rich repeat transmembrane neuronal protein 1

Protein name: leucine rich repeat transmembrane neuronal 1

Full length: 522 amino acids

Entry name: LRRT1_HUMAN

• SKU: ASBPP-3070-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-3070-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 347730