Recombinant Human LTK Protein

Recombinant Human LTK Protein
SKU
ASBPP-3261-20
Packaging Unit
20 μg
Manufacturer
Absea Biotechnology

Availability: loading...
Price is loading...
Note: Dry Ice fees will be extra-charged

Uniprot: P29376

Gene Name: LTK

Expression System: Escherichia coli

Molecular Weight: 31 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: N-SUMO & C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 78%

Start Site: Ala91

End Site: Glu260

Coverage: 0.21

Isoelectric Point: 6.5

Core Sequence: AGTSVVVTVGAAGQLRGVQLWRVPGPGQYLISAYGAAGGKGAKNHLSRAHGVFVSAIFSLGLGESLYILVGQQGEDACPGGSPESQLVCLGESRAVEEHAAMDGSEGVPGSRRWAGGGGGGGGATYVFRVRAGELEPLLVAAGGGGRAYLRPRDRGRTQASPEKLENRSE

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 78%, Pig - 52%, Cynomolgus monkey - 99%

Alternative gene names: TYK1

Alternative protein names: Leukocyte tyrosine kinase receptor; Protein tyrosine kinase 1

Protein name: leukocyte receptor tyrosine kinase

Full length: 864 amino acids

Entry name: LTK_HUMAN

Product panel: Enzyme
More Information
SKU ASBPP-3261-20
Manufacturer Absea Biotechnology
Manufacturer SKU PP-3261-20
Package Unit 20 μg
Quantity Unit STK
Human Gene ID 4058
Product information (PDF)
×
MSDS (PDF)
×