Recombinant Human LTO1 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q8WV07

Gene Name: LTO1

Expression System: Escherichia coli

Molecular Weight: 16.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 77%

Start Site: Met1

End Site: Phe137

Coverage: 1.00

Isoelectric Point: 6.5

Core Sequence: MAGSQDIFDAIVMADERFHGEGYREGYEEGSSLGVMEGRQHGTLHGAKIGSEIGCYQGFAFAWKCLLHSCTTEKDSRKMKVLESLIGMIQKFPYDDPTYDKLHEDLDKIRGKFKQFCSLLNVQPDFKISAEGSGLSF

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 77%, Pig - 91%, Cynomolgus monkey - 99%

Alternative gene names: ORAOV1; TAOS1

Alternative protein names: Protein LTO1 homolog; Oral cancer-overexpressed protein 1; Tumor-amplified and overexpressed sequence 1

Protein name: LTO1 maturation factor of ABCE1

Full length: 137 amino acids

Entry name: LTO1_HUMAN

• SKU: ASBPP-4026-20
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-4026-20
• Package Unit: 20 μg
• Quantity Unit: STK
• Human Gene ID: 220064