Recombinant Human LUC7L2 Protein

Note: Dry Ice fees will be extra-charged

Uniprot: Q9Y383

Gene Name: LUC7L2

Expression System: Escherichia coli

Molecular Weight: 30.5 kDa

Purity: ≥85%

Formulation: Phosphate buffered saline

Tag: C-His

Modification: unmodified

Species: Human

Identity-Mouse (%): 100%

Start Site: Leu11

End Site: Arg250

Coverage: 0.65

Isoelectric Point: 6.5

Core Sequence: LDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEVEKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVVAEKQEKRNQERLKRREER

Homologies: Highest protein sequence identity to the following orthologs: Mouse - 100%, Pig - 100%, Cynomolgus monkey - 100%

Alternative gene names: /

Alternative protein names: Putative RNA-binding protein Luc7-like 2

Protein name: LUC7 like 2, pre-mRNA splicing factor

Full length: 392 amino acids

Entry name: LC7L2_HUMAN

• SKU: ASBPP-2958-100
• Manufacturer: Absea Biotechnology
• Manufacturer SKU: PP-2958-100
• Package Unit: 100 μg
• Quantity Unit: STK
• Human Gene ID: 51631